PDB entry 1b02

View 1b02 on RCSB PDB site
Description: crystal structure of thymidylate synthase a from bacillus subtilis
Class: transferase
Keywords: transferase, methyltransferase
Deposited on 1998-11-16, released 1999-03-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-01-29, with a file datestamp of 2014-01-24.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.194
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (thymidylate synthase)
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b02a_
  • Heterogens: UFP, C2F, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b02A (A:)
    mtqfdkqynsiikdiinngisdeefdvrtkwdsdgtpahtlsviskqmrfdnsevpiltt
    kkvawktaikellwiwqlksndvndlnmmgvhiwdqwkqedgtighaygfqlgkknrsln
    gekvdqvdyllhqlknnpssrrhitmlwnpdeldamaltpcvyetqwyvkhgklhlevra
    rsndmalgnpfnvfqynvlqrmiaqvtgyelgeyifnigdchvytrhidnlkiqmereqf
    eapelwinpevkdfydftiddfklinykhgdkllfevav