PDB entry 1azl

View 1azl on RCSB PDB site
Description: g61v flavodoxin mutant from desulfovibrio vulgaris
Class: electron transport
Keywords: electron transport, electron transfer, flavoprotein, fmn, flavodoxin, mutant
Deposited on 1997-11-18, released 1998-05-20
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.175
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: flavodoxin
    Species: Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough [TaxId:882]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00323 (0-146)
      • engineered (59)
    Domains in SCOPe 2.05: d1azla_
  • Heterogens: FMN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1azlA (A:)
    pkalivygsttgnteytaetiareladagyevdsrdaasveagglfegfdlvllgcstwv
    ddsielqddfiplfdsleetgaqgrkvacfgcgdssyeyfcgavdaieeklknlgaeivq
    dglridgdpraarddivgwahdvrgai