SCOPe 2.05: Domain d1azla_: 1azl A:

Lineage for d1azla_ (1azl A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.5: Flavoproteins [52218] (9 families)

5. Family c.23.5.1: Flavodoxin-related [52219] (6 proteins)
   binds FMN

6. Protein Flavodoxin [52220] (10 species)

7. Species Desulfovibrio vulgaris [TaxId:881] [52222] (25 PDB entries)
   Uniprot P00323

8. Domain d1azla_: 1azl A: [31154]
   complexed with fmn; mutant

Details for d1azla_

PDB Entry: 1azl, 1.8 Å

PDB Description: g61v flavodoxin mutant from desulfovibrio vulgaris

PDB Compounds: (A:) flavodoxin

SCOPe Domain Sequences for d1azla_:

Sequence; same for both SEQRES and ATOM records:

>d1azla_ c.23.5.1 (A:) Flavodoxin {Desulfovibrio vulgaris [TaxId: 881]}
pkalivygsttgnteytaetiareladagyevdsrdaasveagglfegfdlvllgcstwv
ddsielqddfiplfdsleetgaqgrkvacfgcgdssyeyfcgavdaieeklknlgaeivq
dglridgdpraarddivgwahdvrgai

Timeline for d1azla_:

• d1azla_ first appeared (with stable ids) in SCOP 1.55, called d1azl__
  
• d1azla_ appears in SCOPe 2.04
  
• d1azla_ appears in SCOPe 2.06
  
• d1azla_ appears in the current release, SCOPe 2.08