PDB entry 1ayj

View 1ayj on RCSB PDB site
Description: determination of the three-dimensional solution structure of raphanus sativus antifungal protein 1 (rs-afp1) by 1h nmr, 20 structures
Deposited on 1997-11-05, released 1998-01-28
The last revision prior to the SCOP 1.61 freeze date was dated 1998-01-28, with a file datestamp of 1998-01-28.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.61: d1ayj__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ayj_ (-)
    eklcerpsgtwsgvcgnnnacknqcinlekarhgscnyvfpahkcicyfpc