PDB entry 1awu

View 1awu on RCSB PDB site
Description: cypa complexed with hvgpia (pseudo-symmetric monomer)
Class: complex (isomerase/peptide)
Keywords: complex (isomerase/peptide), cyclophilin a, hiv-1 capsid, pseudo-symmetry
Deposited on 1997-10-05, released 1998-03-18
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.34 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyclophilin a
    Species: Homo sapiens [TaxId:9606]
    Gene: CYCLOPHILIN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1awua_
  • Chain 'B':
    Compound: peptide from the hiv-1 capsid protein
    Database cross-references and differences (RAF-indexed):
    • PDB 1AWU (0-5)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1awuA (A:)
    vnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgfm
    cqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictaktew
    ldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle
    

  • Chain 'B':
    No sequence available.