PDB entry 1awo

View 1awo on RCSB PDB site
Description: the solution nmr structure of abl sh3 and its relationship to sh2 in the sh(32) construct, 20 structures
Class: kinase
Keywords: kinase, sh3 domain, transferase, phosphotransferase, proto-oncogene, multiple domain, leukemia
Deposited on 1997-10-03, released 1998-01-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: abl tyrosine kinase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00519 (6-60)
      • conflict (5)
      • conflict (61)
    Domains in SCOPe 2.06: d1awoa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1awoA (A:)
    gspggslfvalydfvasgdntlsitkgeklrvlgynhngewceaqtkngqgwvpsnyitp
    vs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1awoA (A:)
    slfvalydfvasgdntlsitkgeklrvlgynhngewceaqtkngqgwvpsnyitpvs