PDB entry 1awj

View 1awj on RCSB PDB site
Description: intramolecular itk-proline complex, nmr, minimized average structure
Class: transferase
Keywords: transferase, regulatory intramolecular complex, kinase
Deposited on 1997-10-02, released 1998-01-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: itk
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q03526 (0-76)
  Domains in SCOPe 2.06: d1awja_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1awjA (A:)
  kkplpptpednrrsfqepeetlvialydyqtndpqelalrcdeeyylldsseihwwrvqd
  knghegyapssylveks