PDB entry 1aw6

View 1aw6 on RCSB PDB site
Description: gal4 (cd), nmr, 24 structures
Deposited on 1997-10-10, released 1998-04-15
The last revision prior to the SCOP 1.63 freeze date was dated 1998-04-15, with a file datestamp of 1998-04-15.
Experiment type: NMR24
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.63: d1aw6__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aw6_ (-)
    mkllssieqacdicrlkklkcskekpkcakclknnwecryspk