PDB entry 1aw5

View 1aw5 on RCSB PDB site
Description: 5-aminolevulinate dehydratase from saccharomyces cerevisiae
Class: dehydratase
Keywords: dehydratase, tetrapyrrole biosynthesis, aldolase, tim-barrel octamer
Deposited on 1997-10-09, released 1998-10-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5-aminolevulinate dehydratase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: HEM2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05373 (1-339)
      • engineered (39)
      • conflict (59)
      • conflict (116)
      • conflict (121)
      • engineered (180)
      • conflict (218)
      • engineered (252)
      • engineered (271)
      • engineered (294)
    Domains in SCOPe 2.07: d1aw5a_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1aw5A (A:)
    mhtaefletepteissvlaggynhpllrqwqserqltknmlifplfisdnpddfteidsa
    pninrigvnrlkdylkplvakglrsvilfgvplipgtkdpvgtaaddpagpviqgirfir
    ekfpelyiicdvclceytshghcgvlyddgtinrersvsrlaavavnyakagahcvapsd
    midgrirdikrglinanlahktfvlsyaakfsgnlygpardaacsapsngdrkcyqlppa
    grglarralerdmsegadgiivkpstfyldivrdaseickdlpicayhvsgeyamlhaaa
    ekgvvdlktiafeshqgflragarliitylapefldwlde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aw5A (A:)
    mhtaefletepteissvlaggynhpllrqwqserqltknmlifplfisdnpddfteidsa
    pninrigvnrlkdylkplvakglrsvilfgvplipgtkdpvgtaaddpagpviqgirfir
    ekfpelyiicdvclceytshghcgvlyddgtinrersvsrlaavavnyakagahcvapsd
    midgrirdikrglinanlahktfvlsyaakfsgnlygpacyqlppagrglarralerdms
    egadgiivkpstfyldivrdaseickdlpicayhvsgeyamlhaaaekgvvdlktiafes
    hqgflragarliitylapefldwlde