PDB entry 1aui

View 1aui on RCSB PDB site
Description: human calcineurin heterodimer
Class: hydrolase
Keywords: hydrolase, phosphatase, immunosuppression
Deposited on 1997-08-27, released 1997-12-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-02-29, with a file datestamp of 2012-02-24.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.187
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine/threonine phosphatase 2b
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1auia_
  • Chain 'B':
    Compound: serine/threonine phosphatase 2b
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1auib_
  • Heterogens: CA, ZN, FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1auiA (A:)
    msepkaidpklsttdrvvkavpfppshrltakevfdndgkprvdilkahlmkegrleesv
    alriitegasilrqeknlldidapvtvcgdihgqffdlmklfevggspantrylflgdyv
    drgyfsiecvlylwalkilypktlfllrgnhecrhlteyftfkqeckikyservydacmd
    afdclplaalmnqqflcvhgglspeintlddirkldrfkeppaygpmcdilwsdpledfg
    nektqehfthntvrgcsyfysypavceflqhnnllsilraheaqdagyrmyrksqttgfp
    slitifsapnyldvynnkaavlkyennvmnirqfncsphpywlpnfmdvftwslpfvgek
    vtemlvnvlnicsddelgseedgfdgataaarkevirnkiraigkmarvfsvlreesesv
    ltlkgltptgmlpsgvlsggkqtlqsatveaieadeaikgfspqhkitsfeeakgldrin
    ermpprrdampsdanlnsinkaltsetngtdsngsnssniq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1auiA (A:)
    tdrvvkavpfppshrltakevfdndgkprvdilkahlmkegrleesvalriitegasilr
    qeknlldidapvtvcgdihgqffdlmklfevggspantrylflgdyvdrgyfsiecvlyl
    walkilypktlfllrgnhecrhlteyftfkqeckikyservydacmdafdclplaalmnq
    qflcvhgglspeintlddirkldrfkeppaygpmcdilwsdpledfgnektqehfthntv
    rgcsyfysypavceflqhnnllsilraheaqdagyrmyrksqttgfpslitifsapnyld
    vynnkaavlkyennvmnirqfncsphpywlpnfmdvftwslpfvgekvtemlvnvlnics
    sfeeakgldrinermppr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1auiB (B:)
    gneasyplemcshfdadeikrlgkrfkkldldnsgslsveefmslpelqqnplvqrvidi
    fdtdgngevdfkefiegvsqfsvkgdkeqklrfafriydmdkdgyisngelfqvlkmmvg
    nnlkdtqlqqivdktiinadkdgdgrisfeefcavvggldihkkmvvdv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1auiB (B:)
    syplemcshfdadeikrlgkrfkkldldnsgslsveefmslpelqqnplvqrvidifdtd
    gngevdfkefiegvsqfsvkgdkeqklrfafriydmdkdgyisngelfqvlkmmvgnnlk
    dtqlqqivdktiinadkdgdgrisfeefcavvggldihkkmvvdv