PDB entry 1ata

View 1ata on RCSB PDB site
Description: high-resolution structure of ascaris trypsin inhibitor in solution: direct evidence for a ph induced conformational transition in the reactive site
Class: proteinase inhibitor(trypsin)
Keywords: proteinase inhibitor(trypsin)
Deposited on 1994-05-20, released 1994-08-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-12.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ascaris trypsin inhibitor
    Species: Ascaris suum [TaxId:6253]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ataa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ataA (A:)
    eaekctkpneqwtkcggcegtcaqkivpctreckpprceciasagfvrdaqgncikfedc
    pk