PDB entry 1asv

View 1asv on RCSB PDB site
Description: Avian sarcoma virus integrase catalytic core domain
Deposited on 1995-08-25, released 1995-11-14
The last revision prior to the SCOP 1.61 freeze date was dated 1995-11-14, with a file datestamp of 1995-11-15.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.142
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.61: d1asv__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1asv_ (-)
    glgplqiwqtdftleprmaprswlavtvdtassaivvtqhgrvtsvaaqhhwataiavlg
    rpkaiktdngscftskstrewlarwgiahttgipgnsqgqamveranrllkdkirvlaeg
    dgfmkriptskqgellakamyalnhf