PDB entry 1ass

View 1ass on RCSB PDB site
Description: apical domain of the chaperonin from thermoplasma acidophilum
Class: chaperonin
Keywords: chaperonin, hsp60, thermosome, tcp1, groEL, thermoplasma acidophilum, ATP-binding
Deposited on 1997-08-11, released 1997-12-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.222
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thermosome
    Species: Thermoplasma acidophilum [TaxId:2303]
    Gene: THSA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1assa_
  • Heterogens: NA, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1assA (A:)
    msgividkekvhskmpdvvknakialidsaleikkteieakvqisdpskiqdflnqetnt
    fkqmvekikksganvvlcqkgiddvaqhylakegiyavrrvkksdmeklakatgakivtd
    lddltpsvlgeaetveerkigddrmtfvmgcknhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1assA (A:)
    msgividkekvhskmpdvvknakialidsaleikkteieakvqisdpskiqdflnqetnt
    fkqmvekikksganvvlcqkgiddvaqhylakegiyavrrvkksdmeklakatgakivtd
    lddltpsvlgeaetveerkigddrmtfvmgck