SCOPe 2.08: Domain d1assa_: 1ass A:

Lineage for d1assa_ (1ass A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.8: The 'swivelling' beta/beta/alpha domain [52008] (10 superfamilies)
   3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
   this domain is thought to be mobile in most multi-domain proteins known to contain it

4. Superfamily c.8.5: GroEL apical domain-like [52029] (3 families)

5. Family c.8.5.2: Group II chaperonin (CCT, TRIC), apical domain [52034] (1 protein)

6. Protein Thermosome, A-domain [52035] (4 species)

7. Species Thermoplasma acidophilum, alpha chain [TaxId:2303] [100946] (4 PDB entries)

8. Domain d1assa_: 1ass A: [30818]
   apical domain only
   complexed with na, po4

Details for d1assa_

PDB Entry: 1ass, 2.3 Å

PDB Description: apical domain of the chaperonin from thermoplasma acidophilum

PDB Compounds: (A:) thermosome

SCOPe Domain Sequences for d1assa_:

Sequence; same for both SEQRES and ATOM records:

>d1assa_ c.8.5.2 (A:) Thermosome, A-domain {Thermoplasma acidophilum, alpha chain [TaxId: 2303]}
msgividkekvhskmpdvvknakialidsaleikkteieakvqisdpskiqdflnqetnt
fkqmvekikksganvvlcqkgiddvaqhylakegiyavrrvkksdmeklakatgakivtd
lddltpsvlgeaetveerkigddrmtfvmgck

Timeline for d1assa_:

• d1assa_ first appeared (with stable ids) in SCOP 1.55, called d1ass__
  
• d1assa_ appears in SCOPe 2.07