PDB entry 1arq

View 1arq on RCSB PDB site
Description: relaxation matrix refinement of the solution structure of the arc repressor
Class: gene-regulating protein
Keywords: gene-regulating protein
Deposited on 1993-08-24, released 1994-01-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: arc repressor
  Species: Enterobacteria phage P22 [TaxId:10754]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03050 (0-52)
  Domains in SCOPe 2.07: d1arqa_
• Chain 'B':
  Compound: arc repressor
  Species: Enterobacteria phage P22 [TaxId:10754]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03050 (0-52)
  Domains in SCOPe 2.07: d1arqb_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1arqA (A:)
  mkgmskmpqfnlrwprevldlvrkvaeengrsvnseiyqrvmesfkkegriga
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1arqB (B:)
  mkgmskmpqfnlrwprevldlvrkvaeengrsvnseiyqrvmesfkkegriga