PDB entry 1apq

View 1apq on RCSB PDB site
Description: structure of the egf-like module of human c1r, nmr, 19 structures
Class: complement
Keywords: complement, egf, calcium binding, serine protease
Deposited on 1997-07-22, released 1997-09-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: complement protease c1r
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1apqa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1apqA (A:)
    avdldecasrsksgeedpqpqcqhlchnyvggyfcscrpgyelqedrhscqae