PDB entry 1apg

View 1apg on RCSB PDB site
Description: x-ray analysis of substrate analogs in the ricin a-chain active site
Class: glycosidase
Keywords: glycosidase
Deposited on 1992-06-16, released 1994-01-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-08-31, with a file datestamp of 2011-08-26.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.198
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ricin
    Species: Ricinus communis [TaxId:3988]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1apga_
  • Chain 'D':
    Compound: RNA (5'-r(*ap*g)-3')

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1apgA (A:)
    ifpkqypiinfttagatvqsytnfiravrgrlttgadvrheipvlpnrvglpinqrfilv
    elsnhaelsvtlaldvtnayvvgyragnsayffhpdnqedaeaithlftdvqnrytfafg
    gnydrleqlagnlrenielgngpleeaisalyyystggtqlptlarsfiiciqmiseaar
    fqyiegemrtrirynrrsapdpsvitlenswgrlstaiqesnqgafaspiqlqrrngskf
    svydvsilipiialmvyrcapppssqf
    

  • Chain 'D':
    No sequence available.