PDB entry 1ao8

View 1ao8 on RCSB PDB site
Description: dihydrofolate reductase complexed with methotrexate, nmr, 21 structures
Deposited on 1997-07-22, released 1998-02-25
The last revision prior to the SCOP 1.59 freeze date was dated 1998-02-25, with a file datestamp of 1998-02-25.
Experiment type: NMR21
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.59: d1ao8__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ao8_ (-)
    taflwaqdrdgligkdghlpwhlpddlhyfraqtvgkimvvgrrtyesfpkrplpertnv
    vlthqedyqaqgavvvhdvaavfayakqhpdqelviaggaqiftafkddvdtllvtrlag
    sfegdtkmiplnwddftkvssrtvedtnpalthtyevwqkka