PDB entry 1akh

View 1akh on RCSB PDB site
Description: mat a1/alpha2/DNA ternary complex
Class: DNA binding protein/DNA
Keywords: complex (two DNA-binding proteins/DNA), complex, DNA-binding protein, DNA, transcription regulation, DNA binding protein/DNA complex
Deposited on 1997-05-19, released 1998-05-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.201
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (mating-type protein a-1)
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: MAT A1 RESIDUES 66 - 126
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01366
      • conflict (21)
    Domains in SCOPe 2.07: d1akha_
  • Chain 'B':
    Compound: protein (mating-type protein alpha-2)
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: MAT ALPHA2 RESIDUES 128 - 210
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1akhb_
  • Chain 'C':
    Compound: DNA (5'-d(*tp*ap*cp*ap*tp*gp*tp*ap*ap*ap*ap*ap*tp*tp*tp*ap*c p*ap*tp*cp*a)-3')
  • Chain 'D':
    Compound: DNA (5'-d(*tp*ap*tp*gp*ap*tp*gp*tp*ap*ap*ap*tp*tp*tp*tp*tp*a p*cp*ap*tp*g)-3')
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1akhA (A:)
    kkekspkgkssispqarafleevfrrkqslnskekeevakkcgitplqvrvwfinkrmrs
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >1akhA (A:)
    ispqarafleevfrrkqslnskekeevakkcgitplqvrvwfinkrmrs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1akhB (B:)
    tkpyrghrftkenvrileswfaknienpyldtkglenlmkntslsriqiknwvsnrrrke
    ktitiapeladllsgeplakkke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1akhB (B:)
    tkpyrghrftkenvrileswfaknienpyldtkglenlmkntslsriqiknwvsnrrrke
    ktitiapeladllsgepl
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.