PDB entry 1ajy

View 1ajy on RCSB PDB site
Description: structure and mobility of the put3 dimer: a DNA pincer, nmr, 13 structures
Class: transcription regulation
Keywords: transcription regulation, put3
Deposited on 1997-05-12, released 1997-09-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: put3
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P25502 (1-70)
  Domains in SCOPe 2.08: d1ajya1, d1ajya2
• Chain 'B':
  Compound: put3
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P25502 (1-70)
  Domains in SCOPe 2.08: d1ajyb1, d1ajyb2
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ajyA (A:)
  msvaclscrkrhikcpggnpcqkcvtsnaiceylepskkivvstkylqqlqkdlndktee
  nnrlkalller
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ajyB (B:)
  msvaclscrkrhikcpggnpcqkcvtsnaiceylepskkivvstkylqqlqkdlndktee
  nnrlkalller