PDB entry 1ajy

View 1ajy on RCSB PDB site
Description: structure and mobility of the put3 dimer: a DNA pincer, nmr, 13 structures
Class: transcription regulation
Keywords: transcription regulation, put3
Deposited on 1997-05-12, released 1997-09-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: put3
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ajya1, d1ajya2
  • Chain 'B':
    Compound: put3
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ajyb1, d1ajyb2
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ajyA (A:)
    msvaclscrkrhikcpggnpcqkcvtsnaiceylepskkivvstkylqqlqkdlndktee
    nnrlkalller
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ajyB (B:)
    msvaclscrkrhikcpggnpcqkcvtsnaiceylepskkivvstkylqqlqkdlndktee
    nnrlkalller