PDB entry 1aj4

View 1aj4 on RCSB PDB site
Description: structure of calcium-saturated cardiac troponin c, nmr, 1 structure
Class: muscle protein
Keywords: cardiac, muscle protein, regulatory, calcium binding
Deposited on 1997-05-14, released 1998-05-20
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-05-19, with a file datestamp of 2009-05-15.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: troponin c
    Species: Gallus gallus [TaxId:9031]
    Gene: CTNC(A-CYS)
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09860 (2-160)
      • engineered (34)
      • engineered (83)
    Domains in SCOPe 2.04: d1aj4a_
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1aj4A (A:)
    aadiykaaveqlteeqknefkaafdifvlgaedgsistkelgkvmrmlgqnptpeelqem
    idevdedgsgtvdfdeflvmmvrsmkddskgkteeelsdlfrmfdknadgyidleelkim
    lqatgetiteddieelmkdgdknndgridydeflefmkgve
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aj4A (A:)
    adiykaaveqlteeqknefkaafdifvlgaedgsistkelgkvmrmlgqnptpeelqemi
    devdedgsgtvdfdeflvmmvrsmkddskgkteeelsdlfrmfdknadgyidleelkiml
    qatgetiteddieelmkdgdknndgridydeflefmkgve