PDB entry 1agt

View 1agt on RCSB PDB site
Description: solution structure of the potassium channel inhibitor agitoxin 2: caliper for probing channel geometry
Deposited on 1995-04-14, released 1995-07-10
The last revision prior to the SCOP 1.63 freeze date was dated 1995-07-10, with a file datestamp of 1995-07-11.
Experiment type: NMR17
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.63: d1agt__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1agt_ (-)
    gvpinvsctgspqcikpckdagmrfgkcmnrkchctpk