PDB entry 1agp

View 1agp on RCSB PDB site
Description: three-dimensional structures and properties of a transforming and a nontransforming gly-12 mutant of p21-h-ras
Class: oncogene protein
Keywords: oncogene protein
Deposited on 1993-03-29, released 1994-04-30
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-03-07, with a file datestamp of 2012-03-02.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.177
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: c-h-ras p21 protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01112 (0-165)
      • engineered mutation (11)
    Domains in SCOPe 2.04: d1agpa_
  • Heterogens: MG, GNP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1agpA (A:)
    mteyklvvvgadgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
    qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl
    aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh