PDB entry 1acp

View 1acp on RCSB PDB site
Description: refinement of the nmr structures for acyl carrier protein with scalar coupling data
Deposited on 1990-07-29, released 1993-04-15
The last revision prior to the SCOP 1.65 freeze date was dated 1993-04-15, with a file datestamp of 1994-01-31.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.65: d1acp__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1acp_ (-)
  stieervkkiigeqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipdeeae
  kittvqaaidyinghqa