Lineage for d1acp__ (1acp -)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 280342Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 280343Superfamily a.28.1: ACP-like [47336] (3 families) (S)
  5. 280344Family a.28.1.1: Acyl-carrier protein (ACP) [47337] (4 proteins)
  6. 280349Protein Acyl carrier protein [47338] (3 species)
  7. 280355Species Escherichia coli [TaxId:562] [47339] (3 PDB entries)
  8. 280358Domain d1acp__: 1acp - [16931]

Details for d1acp__

PDB Entry: 1acp (more details)

PDB Description: refinement of the nmr structures for acyl carrier protein with scalar coupling data

SCOP Domain Sequences for d1acp__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1acp__ a.28.1.1 (-) Acyl carrier protein {Escherichia coli}
stieervkkiigeqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipdeeae
kittvqaaidyinghqa

SCOP Domain Coordinates for d1acp__:

Click to download the PDB-style file with coordinates for d1acp__.
(The format of our PDB-style files is described here.)

Timeline for d1acp__: