PDB entry 1abo

View 1abo on RCSB PDB site
Description: crystal structure of the complex of the abl tyrosine kinase sh3 domain with 3bp-1 synthetic peptide
Class: complex (kinase/peptide)
Keywords: sh3 domain, transferase (phosphotransferase), proto-oncogene, complex (kinase/peptide) complex
Deposited on 1995-05-19, released 1995-10-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.156
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: abl tyrosine kinase
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1aboa_
  • Chain 'B':
    Compound: abl tyrosine kinase
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1abob_
  • Chain 'C':
    Compound: 3bp-1 synthetic peptide, 10 residues
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: 3bp-1 synthetic peptide, 10 residues
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1aboA (A:)
    mndpnlfvalydfvasgdntlsitkgeklrvlgynhngewceaqtkngqgwvpsnyitpv
    ns
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aboA (A:)
    nlfvalydfvasgdntlsitkgeklrvlgynhngewceaqtkngqgwvpsnyitpvns
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1aboB (B:)
    mndpnlfvalydfvasgdntlsitkgeklrvlgynhngewceaqtkngqgwvpsnyitpv
    ns
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aboB (B:)
    nlfvalydfvasgdntlsitkgeklrvlgynhngewceaqtkngqgwvpsnyitpvns
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.