PDB entry 1abo

View 1abo on RCSB PDB site
Description: crystal structure of the complex of the abl tyrosine kinase sh3 domain with 3bp-1 synthetic peptide
Class: complex (kinase/peptide)
Keywords: sh3 domain, transferase (phosphotransferase), proto-oncogene, complex (kinase/peptide) complex
Deposited on 1995-05-19, released 1995-10-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.156
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: abl tyrosine kinase
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00520 (Start-61)
  Domains in SCOPe 2.08: d1aboa_
• Chain 'B':
  Compound: abl tyrosine kinase
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00520 (Start-61)
  Domains in SCOPe 2.08: d1abob_
• Chain 'C':
  Compound: 3bp-1 synthetic peptide, 10 residues
  Database cross-references and differences (RAF-indexed):
  • Uniprot P55194 (0-9)
• Chain 'D':
  Compound: 3bp-1 synthetic peptide, 10 residues
  Database cross-references and differences (RAF-indexed):
  • Uniprot P55194 (0-9)
• Heterogens: SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1aboA (A:)
  mndpnlfvalydfvasgdntlsitkgeklrvlgynhngewceaqtkngqgwvpsnyitpv
  ns
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1aboA (A:)
  nlfvalydfvasgdntlsitkgeklrvlgynhngewceaqtkngqgwvpsnyitpvns
  

  
  
• Chain 'B':
  Sequence, based on SEQRES records: (download)
  

  >1aboB (B:)
  mndpnlfvalydfvasgdntlsitkgeklrvlgynhngewceaqtkngqgwvpsnyitpv
  ns
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1aboB (B:)
  nlfvalydfvasgdntlsitkgeklrvlgynhngewceaqtkngqgwvpsnyitpvns
  

  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.