Lineage for d1abob_ (1abo B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2782861Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2782862Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2782866Protein Abl tyrosine kinase, SH3 domain [50052] (2 species)
  7. 2782877Species Mouse (Mus musculus) [TaxId:10090] [50053] (3 PDB entries)
  8. 2782880Domain d1abob_: 1abo B: [24475]
    complexed with so4

Details for d1abob_

PDB Entry: 1abo (more details), 2 Å

PDB Description: crystal structure of the complex of the abl tyrosine kinase sh3 domain with 3bp-1 synthetic peptide
PDB Compounds: (B:) abl tyrosine kinase

SCOPe Domain Sequences for d1abob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1abob_ b.34.2.1 (B:) Abl tyrosine kinase, SH3 domain {Mouse (Mus musculus) [TaxId: 10090]}
nlfvalydfvasgdntlsitkgeklrvlgynhngewceaqtkngqgwvpsnyitpvns

SCOPe Domain Coordinates for d1abob_:

Click to download the PDB-style file with coordinates for d1abob_.
(The format of our PDB-style files is described here.)

Timeline for d1abob_: