PDB entry 1aa3

View 1aa3 on RCSB PDB site
Description: c-terminal domain of the e. coli reca, nmr, minimized average structure
Class: double-stranded DNA binding domain
Keywords: DOUBLE-STRANDED DNA BINDING DOMAIN, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics
Deposited on 1997-01-22, released 1997-07-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RecA
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1aa3a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aa3A (A:)
    infygelvdlgvkekliekagawysykgekigqgkanatawlkdnpetakeiekkvrell
    lsn