Lineage for d1aa3a_ (1aa3 A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2514349Fold d.48: Anti-LPS factor/recA domain [54751] (2 superfamilies)
    alpha-beta(3)-alpha(2); 2 layers, alpha/beta
  4. 2514350Superfamily d.48.1: RecA protein, C-terminal domain [54752] (2 families) (S)
  5. 2514351Family d.48.1.1: RecA protein, C-terminal domain [54753] (1 protein)
  6. 2514352Protein RecA protein, C-terminal domain [54754] (5 species)
  7. 2514355Species Escherichia coli [TaxId:562] [54755] (9 PDB entries)
    Uniprot P0A7G6 P03017
  8. 2514364Domain d1aa3a_: 1aa3 A: [38769]

Details for d1aa3a_

PDB Entry: 1aa3 (more details)

PDB Description: c-terminal domain of the e. coli reca, nmr, minimized average structure
PDB Compounds: (A:) RecA

SCOPe Domain Sequences for d1aa3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aa3a_ d.48.1.1 (A:) RecA protein, C-terminal domain {Escherichia coli [TaxId: 562]}
infygelvdlgvkekliekagawysykgekigqgkanatawlkdnpetakeiekkvrell
lsn

SCOPe Domain Coordinates for d1aa3a_:

Click to download the PDB-style file with coordinates for d1aa3a_.
(The format of our PDB-style files is described here.)

Timeline for d1aa3a_: