PDB entry 1a9x

View 1a9x on RCSB PDB site
Description: carbamoyl phosphate synthetase: caught in the act of glutamine hydrolysis
Class: amidotransferase
Keywords: amidotransferase, thioester
Deposited on 1998-04-14, released 1998-10-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.191
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: carbamoyl phosphate synthetase (large chain)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00968
      • conflict (45)
      • conflict (715)
    Domains in SCOPe 2.06: d1a9xa1, d1a9xa2, d1a9xa3, d1a9xa4, d1a9xa5, d1a9xa6
  • Chain 'B':
    Compound: carbamoyl phosphate synthetase (small chain)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00907
      • conflict (181)
      • modified (267)
      • mutation (351)
    Domains in SCOPe 2.06: d1a9xb1, d1a9xb2
  • Chain 'C':
    Compound: carbamoyl phosphate synthetase (large chain)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00968
      • conflict (45)
      • conflict (715)
    Domains in SCOPe 2.06: d1a9xc1, d1a9xc2, d1a9xc3, d1a9xc4, d1a9xc5, d1a9xc6
  • Chain 'D':
    Compound: carbamoyl phosphate synthetase (small chain)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00907
      • conflict (181)
      • modified (267)
      • mutation (351)
    Domains in SCOPe 2.06: d1a9xd1, d1a9xd2
  • Chain 'E':
    Compound: carbamoyl phosphate synthetase (large chain)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00968
      • conflict (45)
      • conflict (715)
    Domains in SCOPe 2.06: d1a9xe1, d1a9xe2, d1a9xe3, d1a9xe4, d1a9xe5, d1a9xe6
  • Chain 'F':
    Compound: carbamoyl phosphate synthetase (small chain)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00907
      • conflict (181)
      • modified (267)
      • mutation (351)
    Domains in SCOPe 2.06: d1a9xf1, d1a9xf2
  • Chain 'G':
    Compound: carbamoyl phosphate synthetase (large chain)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00968 (1-1072)
      • conflict (45)
      • conflict (715)
    Domains in SCOPe 2.06: d1a9xg1, d1a9xg2, d1a9xg3, d1a9xg4, d1a9xg5, d1a9xg6
  • Chain 'H':
    Compound: carbamoyl phosphate synthetase (small chain)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00907 (0-378)
      • conflict (181)
      • modified (267)
      • mutation (351)
    Domains in SCOPe 2.06: d1a9xh1, d1a9xh2
  • Heterogens: MN, K, PO4, CL, ADP, ORN, NET, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1a9xA (A:)
    mpkrtdiksililgagpivigqacefdysgaqackalreegyrvinvnsnpatimtdpem
    adatyiepihwevvrkiiekerpdavlptmggqtalncalelerqgvleefgvtmigata
    daidkaedrrrfdvamkkigletarsgiahtmeealavaadvgfpciirpsftmggsggg
    iaynreefeeicargldlsptkellidesligwkeyemevvrdkndnciivcsienfdam
    gihtgdsitvapaqtltdkeyqimrnasmavlreigvetggsnvqfavnpkngrliviem
    nprvsrssalaskatgfpiakvaaklavgytldelmnditggrtpasfepsidyvvtkip
    rfnfekfagandrlttqmksvgevmaigrtqqeslqkalrglevgatgfdpkvslddpea
    ltkirrelkdagadriwyiadafraglsvdgvfnltnidrwflvqieelvrleekvaevg
    itglnadflrqlkrkgfadarlaklagvreaeirklrdqydlhpvykrvdtcaaefatdt
    aymystyeeeceanpstdrekimvlgggpnrigqgiefdyccvhaslalredgyetimvn
    cnpetvstdydtsdrlyfepvtledvleivriekpkgvivqyggqtplklaraleaagvp
    vigtspdaidraedrerfqhaverlklkqpanatvtaiemavekakeigyplvvrasyvl
    ggrameivydeadlrryfqtavsvsndapvlldhflddavevdvdaicdgemvliggime
    hieqagvhsgdsacslpaytlsqeiqdvmrqqvqklafelqvrglmnvqfavknnevyli
    evnpraartvpfvskatgvplakvaarvmagkslaeqgvtkevippyysvkevvlpfnkf
    pgvdpllgpemrstgevmgvgrtfaeafakaqlgsnstmkkhgrallsvregdkervvdl
    aakllkqgfeldathgtaivlgeaginprlvnkvhegrphiqdrikngeytyiinttsgr
    raiedsrvirrsalqykvhydttlnggfatamalnadatekvisvqemhaqik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a9xA (A:)
    mpkrtdiksililgagpivigqacefdysgaqackalreegyrvinvnsnpatimtdpem
    adatyiepihwevvrkiiekerpdavlptmggqtalncalelerqgvleefgvtmigata
    daidkaedrrrfdvamkkigletarsgiahtmeealavaadvgfpciirpsftmggsggg
    iaynreefeeicargldlsptkellidesligwkeyemevvrdkndnciivcsienfdam
    gihtgdsitvapaqtltdkeyqimrnasmavlreigvetggsnvqfavnpkngrliviem
    nprvsrssalaskatgfpiakvaaklavgytldelmnditggrtpasfepsidyvvtkip
    rfnfekfagandrlttqmksvgevmaigrtqqeslqkalrglevgatgfdpkvslddpea
    ltkirrelkdagadriwyiadafraglsvdgvfnltnidrwflvqieelvrleekvaevg
    itglnadflrqlkrkgfadarlaklagvreaeirklrdqydlhpvykrvdtcaaefatdt
    aymystyeeeceanpstdrekimvlgggpnrigqgiefdyccvhaslalredgyetimvn
    cnpetvstdydtsdrlyfepvtledvleivriekpkgvivqyggqtplklaraleaagvp
    vigtspdaidraedrerfqhaverlklkqpanatvtaiemavekakeigyplvvraamei
    vydeadlrryfqtavlldhflddavevdvdaicdgemvliggimehieqagvhsgdsacs
    lpaytlsqeiqdvmrqqvqklafelqvrglmnvqfavknnevylievnpraartvpfvsk
    atgvplakvaarvmagkslaeqgvtkevippyysvkevvlpfnkfpgvdpllgpemrstg
    evmgvgrtfaeafakaqlgsnstmkkhgrallsvregdkervvdlaakllkqgfeldath
    gtaivlgeaginprlvnkvhegrphiqdrikngeytyiinttsgrraiedsrvirrsalq
    ykvhydttlnggfatamalnadatekvisvqemhaqik
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a9xB (B:)
    iksallvledgtqfhgraigatgsavgevvfntsmtgyqeiltdpsysrqivtltyphig
    nvgtndadeessqvhaqglvirdlpliasnfrntedlssylkrhnivaiadidtrkltrl
    lrekgaqngciiagdnpdaalalekarafpglngmdlakevttaeayswtqgswtltggl
    pqakkedelpfhvvaydfgakrnilrmlvdrgcrltivpaqtsaedvlkmnpdgiflsng
    pgdpapcdyaitaiqkfletdipvfgiclghqllalasgaktvkmkfghhggnhpvkdve
    knvvmitaqnhgfavdeatlpanlrvthkslfdgtlqgihrtdkpafsfqgnpeaspgph
    daaplfdhfielieqyrkt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1a9xC (C:)
    mpkrtdiksililgagpivigqacefdysgaqackalreegyrvinvnsnpatimtdpem
    adatyiepihwevvrkiiekerpdavlptmggqtalncalelerqgvleefgvtmigata
    daidkaedrrrfdvamkkigletarsgiahtmeealavaadvgfpciirpsftmggsggg
    iaynreefeeicargldlsptkellidesligwkeyemevvrdkndnciivcsienfdam
    gihtgdsitvapaqtltdkeyqimrnasmavlreigvetggsnvqfavnpkngrliviem
    nprvsrssalaskatgfpiakvaaklavgytldelmnditggrtpasfepsidyvvtkip
    rfnfekfagandrlttqmksvgevmaigrtqqeslqkalrglevgatgfdpkvslddpea
    ltkirrelkdagadriwyiadafraglsvdgvfnltnidrwflvqieelvrleekvaevg
    itglnadflrqlkrkgfadarlaklagvreaeirklrdqydlhpvykrvdtcaaefatdt
    aymystyeeeceanpstdrekimvlgggpnrigqgiefdyccvhaslalredgyetimvn
    cnpetvstdydtsdrlyfepvtledvleivriekpkgvivqyggqtplklaraleaagvp
    vigtspdaidraedrerfqhaverlklkqpanatvtaiemavekakeigyplvvrasyvl
    ggrameivydeadlrryfqtavsvsndapvlldhflddavevdvdaicdgemvliggime
    hieqagvhsgdsacslpaytlsqeiqdvmrqqvqklafelqvrglmnvqfavknnevyli
    evnpraartvpfvskatgvplakvaarvmagkslaeqgvtkevippyysvkevvlpfnkf
    pgvdpllgpemrstgevmgvgrtfaeafakaqlgsnstmkkhgrallsvregdkervvdl
    aakllkqgfeldathgtaivlgeaginprlvnkvhegrphiqdrikngeytyiinttsgr
    raiedsrvirrsalqykvhydttlnggfatamalnadatekvisvqemhaqik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a9xC (C:)
    mpkrtdiksililgagpivigqacefdysgaqackalreegyrvinvnsnpatimtdpem
    adatyiepihwevvrkiiekerpdavlptmggqtalncalelerqgvleefgvtmigata
    daidkaedrrrfdvamkkigletarsgiahtmeealavaadvgfpciirpsftmggsggg
    iaynreefeeicargldlsptkellidesligwkeyemevvrdkndnciivcsienfdam
    gihtgdsitvapaqtltdkeyqimrnasmavlreigvetggsnvqfavnpkngrliviem
    nprvsrssalaskatgfpiakvaaklavgytldelmnditggrtpasfepsidyvvtkip
    rfnfekfagandrlttqmksvgevmaigrtqqeslqkalrglevgatgfdpkvslddpea
    ltkirrelkdagadriwyiadafraglsvdgvfnltnidrwflvqieelvrleekvaevg
    itglnadflrqlkrkgfadarlaklagvreaeirklrdqydlhpvykrvdtcaaefatdt
    aymystyeeeceanpstdrekimvlgggpnrigqgiefdyccvhaslalredgyetimvn
    cnpetvstdydtsdrlyfepvtledvleivriekpkgvivqyggqtplklaraleaagvp
    vigtspdaidraedrerfqhaverlklkqpanatvtaiemavekakeigyplvvraamei
    vydeadlrryfqtavlldhflddavevdvdaicdgemvliggimehieqagvhsgdsacs
    lpaytlsqeiqdvmrqqvqklafelqvrglmnvqfavknnevylievnpraartvpfvsk
    atgvplakvaarvmagkslaeqgvtkevippyysvkevvlpfnkfpgvdpllgpemrstg
    evmgvgrtfaeafakaqlgsnstmkkhgrallsvregdkervvdlaakllkqgfeldath
    gtaivlgeaginprlvnkvhegrphiqdrikngeytyiinttsgrraiedsrvirrsalq
    ykvhydttlnggfatamalnadatekvisvqemhaqik
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a9xD (D:)
    iksallvledgtqfhgraigatgsavgevvfntsmtgyqeiltdpsysrqivtltyphig
    nvgtndadeessqvhaqglvirdlpliasnfrntedlssylkrhnivaiadidtrkltrl
    lrekgaqngciiagdnpdaalalekarafpglngmdlakevttaeayswtqgswtltggl
    pqakkedelpfhvvaydfgakrnilrmlvdrgcrltivpaqtsaedvlkmnpdgiflsng
    pgdpapcdyaitaiqkfletdipvfgiclghqllalasgaktvkmkfghhggnhpvkdve
    knvvmitaqnhgfavdeatlpanlrvthkslfdgtlqgihrtdkpafsfqgnpeaspgph
    daaplfdhfielieqyrkt
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1a9xE (E:)
    mpkrtdiksililgagpivigqacefdysgaqackalreegyrvinvnsnpatimtdpem
    adatyiepihwevvrkiiekerpdavlptmggqtalncalelerqgvleefgvtmigata
    daidkaedrrrfdvamkkigletarsgiahtmeealavaadvgfpciirpsftmggsggg
    iaynreefeeicargldlsptkellidesligwkeyemevvrdkndnciivcsienfdam
    gihtgdsitvapaqtltdkeyqimrnasmavlreigvetggsnvqfavnpkngrliviem
    nprvsrssalaskatgfpiakvaaklavgytldelmnditggrtpasfepsidyvvtkip
    rfnfekfagandrlttqmksvgevmaigrtqqeslqkalrglevgatgfdpkvslddpea
    ltkirrelkdagadriwyiadafraglsvdgvfnltnidrwflvqieelvrleekvaevg
    itglnadflrqlkrkgfadarlaklagvreaeirklrdqydlhpvykrvdtcaaefatdt
    aymystyeeeceanpstdrekimvlgggpnrigqgiefdyccvhaslalredgyetimvn
    cnpetvstdydtsdrlyfepvtledvleivriekpkgvivqyggqtplklaraleaagvp
    vigtspdaidraedrerfqhaverlklkqpanatvtaiemavekakeigyplvvrasyvl
    ggrameivydeadlrryfqtavsvsndapvlldhflddavevdvdaicdgemvliggime
    hieqagvhsgdsacslpaytlsqeiqdvmrqqvqklafelqvrglmnvqfavknnevyli
    evnpraartvpfvskatgvplakvaarvmagkslaeqgvtkevippyysvkevvlpfnkf
    pgvdpllgpemrstgevmgvgrtfaeafakaqlgsnstmkkhgrallsvregdkervvdl
    aakllkqgfeldathgtaivlgeaginprlvnkvhegrphiqdrikngeytyiinttsgr
    raiedsrvirrsalqykvhydttlnggfatamalnadatekvisvqemhaqik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a9xE (E:)
    mpkrtdiksililgagpivigqacefdysgaqackalreegyrvinvnsnpatimtdpem
    adatyiepihwevvrkiiekerpdavlptmggqtalncalelerqgvleefgvtmigata
    daidkaedrrrfdvamkkigletarsgiahtmeealavaadvgfpciirpsftmggsggg
    iaynreefeeicargldlsptkellidesligwkeyemevvrdkndnciivcsienfdam
    gihtgdsitvapaqtltdkeyqimrnasmavlreigvetggsnvqfavnpkngrliviem
    nprvsrssalaskatgfpiakvaaklavgytldelmnditggrtpasfepsidyvvtkip
    rfnfekfagandrlttqmksvgevmaigrtqqeslqkalrglevgatgfdpkvslddpea
    ltkirrelkdagadriwyiadafraglsvdgvfnltnidrwflvqieelvrleekvaevg
    itglnadflrqlkrkgfadarlaklagvreaeirklrdqydlhpvykrvdtcaaefatdt
    aymystyeeeceanpstdrekimvlgggpnrigqgiefdyccvhaslalredgyetimvn
    cnpetvstdydtsdrlyfepvtledvleivriekpkgvivqyggqtplklaraleaagvp
    vigtspdaidraedrerfqhaverlklkqpanatvtaiemavekakeigyplvvraamei
    vydeadlrryfqtavlldhflddavevdvdaicdgemvliggimehieqagvhsgdsacs
    lpaytlsqeiqdvmrqqvqklafelqvrglmnvqfavknnevylievnpraartvpfvsk
    atgvplakvaarvmagkslaeqgvtkevippyysvkevvlpfnkfpgvdpllgpemrstg
    evmgvgrtfaeafakaqlgsnstmkkhgrallsvregdkervvdlaakllkqgfeldath
    gtaivlgeaginprlvnkvhegrphiqdrikngeytyiinttsgrraiedsrvirrsalq
    ykvhydttlnggfatamalnadatekvisvqemhaqik
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a9xF (F:)
    iksallvledgtqfhgraigatgsavgevvfntsmtgyqeiltdpsysrqivtltyphig
    nvgtndadeessqvhaqglvirdlpliasnfrntedlssylkrhnivaiadidtrkltrl
    lrekgaqngciiagdnpdaalalekarafpglngmdlakevttaeayswtqgswtltggl
    pqakkedelpfhvvaydfgakrnilrmlvdrgcrltivpaqtsaedvlkmnpdgiflsng
    pgdpapcdyaitaiqkfletdipvfgiclghqllalasgaktvkmkfghhggnhpvkdve
    knvvmitaqnhgfavdeatlpanlrvthkslfdgtlqgihrtdkpafsfqgnpeaspgph
    daaplfdhfielieqyrkt
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1a9xG (G:)
    mpkrtdiksililgagpivigqacefdysgaqackalreegyrvinvnsnpatimtdpem
    adatyiepihwevvrkiiekerpdavlptmggqtalncalelerqgvleefgvtmigata
    daidkaedrrrfdvamkkigletarsgiahtmeealavaadvgfpciirpsftmggsggg
    iaynreefeeicargldlsptkellidesligwkeyemevvrdkndnciivcsienfdam
    gihtgdsitvapaqtltdkeyqimrnasmavlreigvetggsnvqfavnpkngrliviem
    nprvsrssalaskatgfpiakvaaklavgytldelmnditggrtpasfepsidyvvtkip
    rfnfekfagandrlttqmksvgevmaigrtqqeslqkalrglevgatgfdpkvslddpea
    ltkirrelkdagadriwyiadafraglsvdgvfnltnidrwflvqieelvrleekvaevg
    itglnadflrqlkrkgfadarlaklagvreaeirklrdqydlhpvykrvdtcaaefatdt
    aymystyeeeceanpstdrekimvlgggpnrigqgiefdyccvhaslalredgyetimvn
    cnpetvstdydtsdrlyfepvtledvleivriekpkgvivqyggqtplklaraleaagvp
    vigtspdaidraedrerfqhaverlklkqpanatvtaiemavekakeigyplvvrasyvl
    ggrameivydeadlrryfqtavsvsndapvlldhflddavevdvdaicdgemvliggime
    hieqagvhsgdsacslpaytlsqeiqdvmrqqvqklafelqvrglmnvqfavknnevyli
    evnpraartvpfvskatgvplakvaarvmagkslaeqgvtkevippyysvkevvlpfnkf
    pgvdpllgpemrstgevmgvgrtfaeafakaqlgsnstmkkhgrallsvregdkervvdl
    aakllkqgfeldathgtaivlgeaginprlvnkvhegrphiqdrikngeytyiinttsgr
    raiedsrvirrsalqykvhydttlnggfatamalnadatekvisvqemhaqik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a9xG (G:)
    mpkrtdiksililgagpivigqacefdysgaqackalreegyrvinvnsnpatimtdpem
    adatyiepihwevvrkiiekerpdavlptmggqtalncalelerqgvleefgvtmigata
    daidkaedrrrfdvamkkigletarsgiahtmeealavaadvgfpciirpsftmggsggg
    iaynreefeeicargldlsptkellidesligwkeyemevvrdkndnciivcsienfdam
    gihtgdsitvapaqtltdkeyqimrnasmavlreigvetggsnvqfavnpkngrliviem
    nprvsrssalaskatgfpiakvaaklavgytldelmnditggrtpasfepsidyvvtkip
    rfnfekfagandrlttqmksvgevmaigrtqqeslqkalrglevgatgfdpkvslddpea
    ltkirrelkdagadriwyiadafraglsvdgvfnltnidrwflvqieelvrleekvaevg
    itglnadflrqlkrkgfadarlaklagvreaeirklrdqydlhpvykrvdtcaaefatdt
    aymystyeeeceanpstdrekimvlgggpnrigqgiefdyccvhaslalredgyetimvn
    cnpetvstdydtsdrlyfepvtledvleivriekpkgvivqyggqtplklaraleaagvp
    vigtspdaidraedrerfqhaverlklkqpanatvtaiemavekakeigyplvvraamei
    vydeadlrryfqtavlldhflddavevdvdaicdgemvliggimehieqagvhsgdsacs
    lpaytlsqeiqdvmrqqvqklafelqvrglmnvqfavknnevylievnpraartvpfvsk
    atgvplakvaarvmagkslaeqgvtkevippyysvkevvlpfnkfpgvdpllgpemrstg
    evmgvgrtfaeafakaqlgsnstmkkhgrallsvregdkervvdlaakllkqgfeldath
    gtaivlgeaginprlvnkvhegrphiqdrikngeytyiinttsgrraiedsrvirrsalq
    ykvhydttlnggfatamalnadatekvisvqemhaqik
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a9xH (H:)
    iksallvledgtqfhgraigatgsavgevvfntsmtgyqeiltdpsysrqivtltyphig
    nvgtndadeessqvhaqglvirdlpliasnfrntedlssylkrhnivaiadidtrkltrl
    lrekgaqngciiagdnpdaalalekarafpglngmdlakevttaeayswtqgswtltggl
    pqakkedelpfhvvaydfgakrnilrmlvdrgcrltivpaqtsaedvlkmnpdgiflsng
    pgdpapcdyaitaiqkfletdipvfgiclghqllalasgaktvkmkfghhggnhpvkdve
    knvvmitaqnhgfavdeatlpanlrvthkslfdgtlqgihrtdkpafsfqgnpeaspgph
    daaplfdhfielieqyrkt