PDB entry 1a73

View 1a73 on RCSB PDB site
Description: intron-encoded endonuclease I-ppoi complexed with DNA
Class: hydrolase/DNA
Keywords: complex (homing endonuclease/DNA), intron, zinc, DNA binding, protein folding, hydrolase/DNA complex
Deposited on 1998-03-19, released 1998-10-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.208
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: intron 3 (I-ppo) encoded endonuclease
    Species: Physarum polycephalum [TaxId:5791]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a73a_
  • Chain 'B':
    Compound: intron 3 (I-ppo) encoded endonuclease
    Species: Physarum polycephalum [TaxId:5791]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a73b_
  • Chain 'C':
    Compound: DNA (5'-d(*tp*tp*gp*ap*cp*tp*cp*tp*cp*tp*tp*ap*a)-3')
  • Chain 'D':
    Compound: DNA (5'-d(p*gp*ap*gp*ap*gp*tp*cp*a)-3')
  • Chain 'E':
    Compound: DNA (5'-d(*tp*tp*gp*ap*cp*tp*cp*tp*cp*tp*tp*ap*a)-3')
  • Chain 'F':
    Compound: DNA (5'-d(p*gp*ap*gp*ap*gp*tp*cp*a)-3')
  • Heterogens: ZN, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1a73A (A:)
    maltnaqilavidsweetvgqfpvithhvplggglqgtlhcyeiplaapygvgfakngpt
    rwqykrtinqvvhrwgshtvpfllepdningktctashlchntrchnplhlcweslddnk
    grnwcpgpnggcvhavvclrqgplygpgatvagpqqrgshfvv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a73A (A:)
    altnaqilavidsweetvgqfpvithhvplggglqgtlhcyeiplaapygvgfakngptr
    wqykrtinqvvhrwgshtvpfllepdningktctashlchntrchnplhlcweslddnkg
    rnwcpgpnggcvhavvclrqgplygpgatvagpqqrgshfvv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1a73B (B:)
    maltnaqilavidsweetvgqfpvithhvplggglqgtlhcyeiplaapygvgfakngpt
    rwqykrtinqvvhrwgshtvpfllepdningktctashlchntrchnplhlcweslddnk
    grnwcpgpnggcvhavvclrqgplygpgatvagpqqrgshfvv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a73B (B:)
    altnaqilavidsweetvgqfpvithhvplggglqgtlhcyeiplaapygvgfakngptr
    wqykrtinqvvhrwgshtvpfllepdningktctashlchntrchnplhlcweslddnkg
    rnwcpgpnggcvhavvclrqgplygpgatvagpqqrgshfvv
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.