Lineage for d1a73b_ (1a73 B:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.4: His-Me finger endonucleases [54059] (1 superfamily)
    core: (alpha)-beta-omega_loop-beta-alpha; embeded in larger different structures
  4. Superfamily d.4.1: His-Me finger endonucleases [54060] (8 families) (S)
    common motif contains conserved histidine residue and metal-binding site
  5. Family d.4.1.3: Intron-encoded homing endonucleases [54069] (2 proteins)
  6. Protein Intron-encoded homing endonuclease I-PpoI [54070] (1 species)
  7. Species Slime mold (Physarum polycephalum) [TaxId:5791] [54071] (8 PDB entries)
  8. Domain d1a73b_: 1a73 B: [37146]
    protein/DNA complex; complexed with mg, zn

Details for d1a73b_

PDB Entry: 1a73 (more details), 1.8 Å

PDB Description: intron-encoded endonuclease i-ppoi complexed with dna
PDB Compounds: (B:) intron 3 (I-ppo) encoded endonuclease

SCOPe Domain Sequences for d1a73b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a73b_ d.4.1.3 (B:) Intron-encoded homing endonuclease I-PpoI {Slime mold (Physarum polycephalum) [TaxId: 5791]}
altnaqilavidsweetvgqfpvithhvplggglqgtlhcyeiplaapygvgfakngptr
wqykrtinqvvhrwgshtvpfllepdningktctashlchntrchnplhlcweslddnkg
rnwcpgpnggcvhavvclrqgplygpgatvagpqqrgshfvv

SCOPe Domain Coordinates for d1a73b_ are not available.

Timeline for d1a73b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1a73a_