PDB entry 1a62

View 1a62 on RCSB PDB site
Description: crystal structure of the RNA-binding domain of the transcriptional terminator protein rho
Class: transcription termination
Keywords: transcription termination, termination, RNA binding domain, transcription regulation, ob fold, f1-ATPase
Deposited on 1998-03-05, released 1998-06-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.216
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rho
    Species: Escherichia coli BL21(DE3) [TaxId:469008]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03002 (1-End)
      • modified residue (20)
      • modified residue (28)
    Domains in SCOPe 2.08: d1a62a1, d1a62a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1a62A (A:)
    mnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksgedifgdgvleilqd
    gfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkegeryfallkvnevn
    fdkpenarnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a62A (A:)
    mnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksgedifgdgvleilqd
    gfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkegeryfallkvnevn
    fdkpe