PDB entry 1a44

View 1a44 on RCSB PDB site
Description: phosphatidylethanolamine binding protein from calf brain
Class: lipid-binding protein
Keywords: lipid-binding, lipid-binding protein
Deposited on 1998-02-10, released 1999-01-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.84 Å
R-factor: 0.148
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphatidylethanolamine-binding protein
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1a44a_
  • Heterogens: ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1a44A (A:)
pvdlskwsgplslqevderpqhplqvkyggaevdelgkvltptqvknrptsitwdgldpg
klytlvltdpdapsrkdpkyrewhhflvvnmkgnnissgtvlsdyvgsgppkgtglhryv
wlvyeqegplkcdepilsnrsgdhrgkfkvasfrkkyelgapvagtcyqaewddyvpkly
eqlsg