![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.17: PEBP-like [49776] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds |
![]() | Superfamily b.17.1: PEBP-like [49777] (3 families) ![]() |
![]() | Family b.17.1.1: Phosphatidylethanolamine binding protein [49778] (4 proteins) |
![]() | Protein Phosphatidylethanolamine binding protein, PEBP [49779] (4 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [49781] (2 PDB entries) |
![]() | Domain d1a44a_: 1a44 A: [23704] complexed with act |
PDB Entry: 1a44 (more details), 1.84 Å
SCOPe Domain Sequences for d1a44a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a44a_ b.17.1.1 (A:) Phosphatidylethanolamine binding protein, PEBP {Cow (Bos taurus) [TaxId: 9913]} pvdlskwsgplslqevderpqhplqvkyggaevdelgkvltptqvknrptsitwdgldpg klytlvltdpdapsrkdpkyrewhhflvvnmkgnnissgtvlsdyvgsgppkgtglhryv wlvyeqegplkcdepilsnrsgdhrgkfkvasfrkkyelgapvagtcyqaewddyvpkly eqlsg
Timeline for d1a44a_: