Lineage for d1a44a_ (1a44 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774037Fold b.17: PEBP-like [49776] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 2774038Superfamily b.17.1: PEBP-like [49777] (3 families) (S)
  5. 2774039Family b.17.1.1: Phosphatidylethanolamine binding protein [49778] (4 proteins)
  6. 2774047Protein Phosphatidylethanolamine binding protein, PEBP [49779] (4 species)
  7. 2774048Species Cow (Bos taurus) [TaxId:9913] [49781] (2 PDB entries)
  8. 2774049Domain d1a44a_: 1a44 A: [23704]
    complexed with act

Details for d1a44a_

PDB Entry: 1a44 (more details), 1.84 Å

PDB Description: phosphatidylethanolamine binding protein from calf brain
PDB Compounds: (A:) phosphatidylethanolamine-binding protein

SCOPe Domain Sequences for d1a44a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a44a_ b.17.1.1 (A:) Phosphatidylethanolamine binding protein, PEBP {Cow (Bos taurus) [TaxId: 9913]}
pvdlskwsgplslqevderpqhplqvkyggaevdelgkvltptqvknrptsitwdgldpg
klytlvltdpdapsrkdpkyrewhhflvvnmkgnnissgtvlsdyvgsgppkgtglhryv
wlvyeqegplkcdepilsnrsgdhrgkfkvasfrkkyelgapvagtcyqaewddyvpkly
eqlsg

SCOPe Domain Coordinates for d1a44a_:

Click to download the PDB-style file with coordinates for d1a44a_.
(The format of our PDB-style files is described here.)

Timeline for d1a44a_: