PDB entry 1a43

View 1a43 on RCSB PDB site
Description: structure of the hiv-1 capsid protein dimerization domain at 2.6a resolution
Class: Viral protein
Keywords: CAPSID, ASSEMBLY PROTEIN, HIV-1, Viral protein
Deposited on 1998-02-10, released 1999-02-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-23.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.223
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hiv-1 capsid
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a43a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1a43A (A:)
    msptsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilka
    lgpgatleemmtacqgvggpghkarvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a43A (A:)
    tsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalgp
    gatleemmtacq