PDB entry 1a1l

View 1a1l on RCSB PDB site
Description: zif268 zinc finger-dna complex (gcac site)
Deposited on 1997-12-10, released 1998-06-10
The last revision prior to the SCOP 1.59 freeze date was dated 1998-06-10, with a file datestamp of 1998-06-10.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.196
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.59: d1a1la1, d1a1la2, d1a1la3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1a1lA (A:)
  rpyacpvescdrrfsrsdeltrhirihtgqkpfqcricmrnfsrsdhltthirthtgekp
  facdicgrkfarsderkrhtkihlr