PDB entry 1a1k

View 1a1k on RCSB PDB site
Description: radr (zif268 variant) zinc finger-dna complex (gacc site)
Deposited on 1997-12-10, released 1998-06-10
The last revision prior to the SCOP 1.61 freeze date was dated 1998-06-10, with a file datestamp of 1998-06-10.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.21
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a1kA (A:)
    rpyacpvescdrrfsrsadltrhirihtgqkpfqcricmrnfsrsdhltthirthtgekp
    facdicgrkfarsderkrhtkihlr