PDB entry 1a1i

View 1a1i on RCSB PDB site
Description: radr (zif268 variant) zinc finger-dna complex (gcac site)
Deposited on 1997-12-10, released 1998-06-10
The last revision prior to the SCOP 1.61 freeze date was dated 1998-06-10, with a file datestamp of 1998-06-10.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.191
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.61: d1a1ia1, d1a1ia2, d1a1ia3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1a1iA (A:)
  rpyacpvescdrrfsrsadltrhirihtgqkpfqcricmrnfsrsdhltthirthtgekp
  facdicgrkfarsderkrhtkihlr