PDB entry 1a1h

View 1a1h on RCSB PDB site
Description: qgsr (zif268 variant) zinc finger-dna complex (gcac site)
Deposited on 1997-12-10, released 1998-06-10
The last revision prior to the SCOP 1.61 freeze date was dated 1998-06-10, with a file datestamp of 1998-06-10.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.235
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.61: d1a1ha1, d1a1ha2, d1a1ha3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1a1hA (A:)
  rpyacpvescdrrfsqsgsltrhirihtgqkpfqcricmrnfsrsdhltthirthtgekp
  facdicgrkfarsderkrhtkihlr