PDB entry 1a1f

View 1a1f on RCSB PDB site
Description: dsnr (zif268 variant) zinc finger-dna complex (gacc site)
Deposited on 1997-12-10, released 1998-06-10
The last revision prior to the SCOP 1.61 freeze date was dated 1998-06-10, with a file datestamp of 1998-06-10.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.225
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.61: d1a1fa1, d1a1fa2, d1a1fa3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1a1fA (A:)
  rpyacpvescdrrfsdssnltrhirihtgqkpfqcricmrnfsrsdhltthirthtgekp
  facdicgrkfarsderkrhtkihl