PDB entry 1a18

View 1a18 on RCSB PDB site
Description: phenanthroline modified murine adipocyte lipid binding protein
Class: fatty acid binding protein
Keywords: fatty acid binding protein, transport, phosphorylation
Deposited on 1997-12-23, released 1998-07-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.196
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: adipocyte lipid binding protein
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04117 (0-130)
    • modified residue (116)
  Domains in SCOPe 2.07: d1a18a_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1a18A (A:)
  cdafvgtwklvssenfddymkevgvgfatrkvagmakpnmiisvngdlvtirsestfknt
  eisfklgvefdeitaddrkvksiitldggalvqvqkwdgksttikrkrdgdklvvecvmk
  gvtstrvyera