PDB entry 1a0k

View 1a0k on RCSB PDB site
Description: profilin I from arabidopsis thaliana
Class: cytoskeleton
Keywords: profilin, cytoskeleton, actin-binding
Deposited on 1997-12-02, released 1998-03-18
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.172
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Profilin
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: PFN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1a0ka_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1a0kA (A:)
    mswqsyvddhlmcdvegnhltaaailgqdgsvwaqsakfpqlkpqeidgikkdfeepgfl
    aptglflggekymviqgeqgavirgkkgpggvtikktnqalvfgfydepmtggqcnlvve
    rlgdyliesel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a0kA (A:)
    swqsyvddhlmcdvegnhltaaailgqdgsvwaqsakfpqlkpqeidgikkdfeepgfla
    ptglflggekymviqgeqgavirgkkgpggvtikktnqalvfgfydepmtggqcnlvver
    lgdyliesel