PDB entry 1a0k
View 1a0k on RCSB PDB site
Description: profilin I from arabidopsis thaliana
Class: cytoskeleton
Keywords: profilin, cytoskeleton, actin-binding
Deposited on
1997-12-02, released
1998-03-18
The last revision prior to the SCOPe 2.02 freeze date was dated
2009-02-24, with a file datestamp of
2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.172
AEROSPACI score: 0.4
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Profilin
Species: Arabidopsis thaliana [TaxId:3702]
Gene: PFN
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.02: d1a0ka_ - Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>1a0kA (A:)
mswqsyvddhlmcdvegnhltaaailgqdgsvwaqsakfpqlkpqeidgikkdfeepgfl
aptglflggekymviqgeqgavirgkkgpggvtikktnqalvfgfydepmtggqcnlvve
rlgdyliesel
Sequence, based on observed residues (ATOM records): (download)
>1a0kA (A:)
swqsyvddhlmcdvegnhltaaailgqdgsvwaqsakfpqlkpqeidgikkdfeepgfla
ptglflggekymviqgeqgavirgkkgpggvtikktnqalvfgfydepmtggqcnlvver
lgdyliesel