PDB entry 155c

View 155c on RCSB PDB site
Description: the structure of paracoccus denitrificans cytochrome c550
Class: electron transport
Keywords: electron transport
Deposited on 1976-08-01, released 1976-08-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-08-25, with a file datestamp of 2009-08-21.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cytochrome c550
  Species: Paracoccus denitrificans [TaxId:266]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00096 (2-120)
    • conflict (73)
    • conflict (84-86)
    • conflict (116-117)
  Domains in SCOPe 2.08: d155ca_
• Heterogens: HEM

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >155cA (A:)
  negdaakgekefnkckachmiqapdgtdikggktgpnlygvvgrkiaseegfkygegile
  vaeknpdltwteanlieyvtdpkplvkkmtddkgaktkmtfkmgknqadvvaflaqddpd
  axxxxxxxxxxxxx