Lineage for d155ca_ (155c A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2690796Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2690797Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2690798Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 2690809Protein Cytochrome c2 [46650] (8 species)
  7. 2690810Species Paracoccus denitrificans [TaxId:266] [46657] (2 PDB entries)
  8. 2690812Domain d155ca_: 155c A: [15900]
    complexed with hem

Details for d155ca_

PDB Entry: 155c (more details), 2.5 Å

PDB Description: the structure of paracoccus denitrificans cytochrome c550
PDB Compounds: (A:) cytochrome c550

SCOPe Domain Sequences for d155ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d155ca_ a.3.1.1 (A:) Cytochrome c2 {Paracoccus denitrificans [TaxId: 266]}
negdaakgekefnkckachmiqapdgtdikggktgpnlygvvgrkiaseegfkygegile
vaeknpdltwteanlieyvtdpkplvkkmtddkgaktkmtfkmgknqadvvaflaqddpd
axxxxxxxxxxxxx

SCOPe Domain Coordinates for d155ca_:

Click to download the PDB-style file with coordinates for d155ca_.
(The format of our PDB-style files is described here.)

Timeline for d155ca_: