SCOPe 2.08: Domain d155ca_: 155c A:

Lineage for d155ca_ (155c A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)

6. Protein Cytochrome c2 [46650] (8 species)

7. Species Paracoccus denitrificans [TaxId:266] [46657] (2 PDB entries)

8. Domain d155ca_: 155c A: [15900]
   complexed with hem

Details for d155ca_

PDB Entry: 155c, 2.5 Å

PDB Description: the structure of paracoccus denitrificans cytochrome c550

PDB Compounds: (A:) cytochrome c550

SCOPe Domain Sequences for d155ca_:

Sequence; same for both SEQRES and ATOM records:

>d155ca_ a.3.1.1 (A:) Cytochrome c2 {Paracoccus denitrificans [TaxId: 266]}
negdaakgekefnkckachmiqapdgtdikggktgpnlygvvgrkiaseegfkygegile
vaeknpdltwteanlieyvtdpkplvkkmtddkgaktkmtfkmgknqadvvaflaqddpd
axxxxxxxxxxxxx

Timeline for d155ca_:

• d155ca_ first appeared (with stable ids) in SCOP 1.55, called d155c__
  
• d155ca_ appears in SCOPe 2.07