![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
![]() | Superfamily a.3.1: Cytochrome c [46626] (9 families) ![]() covalently-bound heme completes the core |
![]() | Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins) |
![]() | Protein Cytochrome c2 [46650] (8 species) |
![]() | Species Paracoccus denitrificans [TaxId:266] [46657] (2 PDB entries) |
![]() | Domain d155ca_: 155c A: [15900] complexed with hem |
PDB Entry: 155c (more details), 2.5 Å
SCOPe Domain Sequences for d155ca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d155ca_ a.3.1.1 (A:) Cytochrome c2 {Paracoccus denitrificans [TaxId: 266]} negdaakgekefnkckachmiqapdgtdikggktgpnlygvvgrkiaseegfkygegile vaeknpdltwteanlieyvtdpkplvkkmtddkgaktkmtfkmgknqadvvaflaqddpd axxxxxxxxxxxxx
Timeline for d155ca_: