PDB entry 117e

View 117e on RCSB PDB site
Description: the r78k and d117e active site variants of saccharomyces cerevisiae soluble inorganic pyrophosphatase: structural studies and mechanistic implications
Class: hydrolase
Keywords: enzyme mechanism, iorganic pyrophosphatase, mutan structures, 2-metal ion mechanism, hydrolase
Deposited on 1998-09-15, released 1998-12-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.182
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (inorganic pyrophosphatase)
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: PPA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d117ea_
  • Chain 'B':
    Compound: protein (inorganic pyrophosphatase)
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: PPA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d117eb_
  • Heterogens: MN, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >117eA (A:)
    tyttrqigakntleykvyiekdgkpvsafhdiplyadkennifnmvveiprwtnakleit
    keetlnpiiqdtkkgklrfvrncfphhgyihnygafpqtwedpnvshpetkavgdnepid
    vleigetiaytgqvkqvkalgimalldegetdwkviaidindplapklndiedvekyfpg
    llratnewfriykipdgkpenqfafsgeaknkkyaldiikethdswkqliagkssdskgi
    dltnvtlpdtptyskaasdaippaslkadapidksidkwffisgsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >117eA (A:)
    tyttrqigakntleykvyiekdgkpvsafhdiplyadkennifnmvveiprwtnakleit
    keetlnpiiqdtkkgklrfvrncfphhgyihnygafpqtwedpnvshpetkavgdnepid
    vleigetiaytgqvkqvkalgimalldegetdwkviaidindplapklndiedvekyfpg
    llratnewfriykipdgkpenqfafsgeaknkkyaldiikethdswkqliagkssdskgi
    dltnvtlpdtptyskaasdaippaslkadapidksidkwffi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >117eB (B:)
    tyttrqigakntleykvyiekdgkpvsafhdiplyadkennifnmvveiprwtnakleit
    keetlnpiiqdtkkgklrfvrncfphhgyihnygafpqtwedpnvshpetkavgdnepid
    vleigetiaytgqvkqvkalgimalldegetdwkviaidindplapklndiedvekyfpg
    llratnewfriykipdgkpenqfafsgeaknkkyaldiikethdswkqliagkssdskgi
    dltnvtlpdtptyskaasdaippaslkadapidksidkwffisgsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >117eB (B:)
    tyttrqigakntleykvyiekdgkpvsafhdiplyadkennifnmvveiprwtnakleit
    keetlnpiiqdtkkgklrfvrncfphhgyihnygafpqtwedpnvshpetkavgdnepid
    vleigetiaytgqvkqvkalgimalldegetdwkviaidindplapklndiedvekyfpg
    llratnewfriykipdgkpenqfafsgeaknkkyaldiikethdswkqliagkssdskgi
    dltnvtlpdtptyskaasdaippaslkadapidksidkwffi