Lineage for d117ea_ (117e A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2381452Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2384029Superfamily b.40.5: Inorganic pyrophosphatase [50324] (2 families) (S)
  5. 2384030Family b.40.5.1: Inorganic pyrophosphatase [50325] (2 protein domains)
    barrel, closed; n=5, S=8
  6. 2384031Protein Inorganic pyrophosphatase [50326] (9 species)
    eukaryotic enzyme has additional secondary structures at both N- and C-termini
  7. 2384032Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [50327] (19 PDB entries)
  8. 2384061Domain d117ea_: 117e A: [25401]
    complexed with mn, po4

Details for d117ea_

PDB Entry: 117e (more details), 2.15 Å

PDB Description: the r78k and d117e active site variants of saccharomyces cerevisiae soluble inorganic pyrophosphatase: structural studies and mechanistic implications
PDB Compounds: (A:) protein (inorganic pyrophosphatase)

SCOPe Domain Sequences for d117ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d117ea_ b.40.5.1 (A:) Inorganic pyrophosphatase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tyttrqigakntleykvyiekdgkpvsafhdiplyadkennifnmvveiprwtnakleit
keetlnpiiqdtkkgklrfvrncfphhgyihnygafpqtwedpnvshpetkavgdnepid
vleigetiaytgqvkqvkalgimalldegetdwkviaidindplapklndiedvekyfpg
llratnewfriykipdgkpenqfafsgeaknkkyaldiikethdswkqliagkssdskgi
dltnvtlpdtptyskaasdaippaslkadapidksidkwffi

SCOPe Domain Coordinates for d117ea_:

Click to download the PDB-style file with coordinates for d117ea_.
(The format of our PDB-style files is described here.)

Timeline for d117ea_: