SCOPe 2.08: Domain d1ut9a2: 1ut9 A:208-305

Lineage for d1ut9a2 (1ut9 A:208-305)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (27 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (21 proteins)
   domains of unknown function associated with different type of catalytic domains in a different sequential location
   subgroup of the larger IPT/TIG domain family

6. Protein Cellulose 1,4-beta-cellobiosidase CbhA, precatalytic domain [101521] (1 species)

7. Species Clostridium thermocellum [TaxId:1515] [101522] (2 PDB entries)

8. Domain d1ut9a2: 1ut9 A:208-305 [99913]
   Other proteins in same PDB: d1ut9a1

Details for d1ut9a2

PDB Entry: 1ut9, 2.1 Å

PDB Description: structural basis for the exocellulase activity of the cellobiohydrolase cbha from c. thermocellum

PDB Compounds: (A:) Cellulose 1,4-beta-cellobiosidase

SCOPe Domain Sequences for d1ut9a2:

Sequence; same for both SEQRES and ATOM records:

>d1ut9a2 b.1.18.2 (A:208-305) Cellulose 1,4-beta-cellobiosidase CbhA, precatalytic domain {Clostridium thermocellum [TaxId: 1515]}
ilpqpdvrvnqvgylpegkkvatvvcnstqpvkwqlknaagvvvlegytepkgldkdsqd
yvhwldfsdfategigyyfelptvnsptnyshpfdirk

Timeline for d1ut9a2:

• d1ut9a2 first appeared in SCOP 1.67
  
• d1ut9a2 appears in SCOPe 2.07