SCOPe 2.04: Domain d1ut5a1: 1ut5 A:186-291

Lineage for d1ut5a1 (1ut5 A:186-291)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.7: 5' to 3' exonuclease, C-terminal subdomain [47807] (2 families)

5. Family a.60.7.1: 5' to 3' exonuclease, C-terminal subdomain [47808] (4 proteins)

6. Protein T5 5'-exonuclease [47813] (1 species)

7. Species Bacteriophage T5 [TaxId:10726] [47814] (4 PDB entries)

8. Domain d1ut5a1: 1ut5 A:186-291 [99902]
   Other proteins in same PDB: d1ut5a2, d1ut5b2
   complexed with mn

Details for d1ut5a1

PDB Entry: 1ut5, 2.75 Å

PDB Description: divalent metal ions (manganese) bound to t5 5'-exonuclease

PDB Compounds: (A:) exodeoxyribonuclease

SCOPe Domain Sequences for d1ut5a1:

Sequence; same for both SEQRES and ATOM records:

>d1ut5a1 a.60.7.1 (A:186-291) T5 5'-exonuclease {Bacteriophage T5 [TaxId: 10726]}
vddveqfislkaimgdlgdnirgvegigakrgyniirefgnvldiidqlplpgkqkyiqn
lnaseellfrnlilvdlptycvdaiaavgqdvldkftkdileiaeq

Timeline for d1ut5a1:

• d1ut5a1 first appeared in SCOP 1.67
  
• d1ut5a1 appears in SCOPe 2.03
  
• d1ut5a1 appears in SCOPe 2.05
  
• d1ut5a1 appears in the current release, SCOPe 2.08