Lineage for d1usua_ (1usu A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 598219Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 598220Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (12 families) (S)
  5. 598436Family d.14.1.8: Hsp90 middle domain [102755] (1 protein)
    related to the DNA gyrase/MutL family; contains extra C-terminal alpha/beta subdomain
  6. 598437Protein Heat shock protein hsp82 [102756] (1 species)
  7. 598438Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [102757] (3 PDB entries)
  8. 598439Domain d1usua_: 1usu A: [99885]
    Other proteins in same PDB: d1usub_
    complexed with Aha1
    complexed with gol

Details for d1usua_

PDB Entry: 1usu (more details), 2.15 Å

PDB Description: the structure of the complex between aha1 and hsp90

SCOP Domain Sequences for d1usua_:

Sequence, based on SEQRES records: (download)

>d1usua_ d.14.1.8 (A:) Heat shock protein hsp82 {Baker's yeast (Saccharomyces cerevisiae)}
ptkplwtrnpsditqeeynafyksisndwedplyvkhfsvegqlefrailfipkrapfdl
feskkkknniklyvrrvfitdeaedlipewlsfvkgvvdsedlplnlsremlqqnkimkv
irknivkklieafneiaedseqfekfysafskniklgvhedtqnraalakllrynstksv
deltsltdyvtrmpehqkniyyitgeslksvekspfldalkaknfevlfltdpideyaft
qlkefegktlvditkd

Sequence, based on observed residues (ATOM records): (download)

>d1usua_ d.14.1.8 (A:) Heat shock protein hsp82 {Baker's yeast (Saccharomyces cerevisiae)}
ptkplwtrnpsditqeeynafyksisndwedplyvkhfsvegqlefrailfipkrapfdl
fesnniklyvrrvfitdeaedlipewlsfvkgvvdsedlplnlqnkimkvirknivkkli
eafneiaedseqfekfysafskniklgvhedtqnraalakllrynstksvdeltsltdyv
trmpehqkniyyitgeslksvekspfldalkaknfevlfltdpideyaftqlkefegktl
vditkd

SCOP Domain Coordinates for d1usua_:

Click to download the PDB-style file with coordinates for d1usua_.
(The format of our PDB-style files is described here.)

Timeline for d1usua_: